HORDB

General Information

ID: hor006590
Uniprot ID: Q7Z4H4
Protein name: Adrenomedullin-2
Gene name: ADM2
Organism: Homo sapiens (Human)
Family: Adrenomedullin family
Source: Human
Expression: Expressed in the esophagus, stomach, jejunum, ileum, ileocecum, ascending colon, transverse colon, descending colon and rectum. Expressed in myocardial cells of the heart, renal tubular cells, hypothalamus, and pituitary.
Disease: Diseases associated with ADM2 include Immunodeficiency 53 and Coronary Stenosis.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0044877 protein-containing complex binding
GO BP: GO:0001525 angiogenesis; GO:0003073 regulation of systemic arterial blood pressure; GO:0006468 protein phosphorylation; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007631 feeding behavior; GO:0010460 positive regulation of heart rate; GO:0010628 positive regulation of gene expression; GO:0045766 positive regulation of angiogenesis; GO:0045776 negative regulation of blood pressure
GO CC: GO:0005576 extracellular region

Sequence Information

Sequence: TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY
Length: 47
Propeptide: MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG
Signal peptide: MARIPTAALGCISLLCLQLPGSLS
Modification: T47 Tyrosine amide
Glycosylation: NA
Mutagenesis: NA

Activity

Function: [Adrenomedullin-2]: May play a role as physiological regulators of gastrointestinal, cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: 10-15
Structure ID: AF-Q7Z4H4-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006590_AF2.pdb

hor006590_ESM.pdb

Physical Information

Mass:	592448	Formula:	C219H350N68O67S3
Absent amino acids:	EFIK	Common amino acids:	LQ
pI:	8.25	Basic residues:	5
Polar residues:	15	Hydrophobic residues:	14
Hydrophobicity:	-32.13	Boman Index:	-7157
Half-Life:	7.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	80.85
Instability Index:	4782.77	Extinction Coefficient cystines:	7115
Absorbance 280nm:	154.67

Literature

PubMed ID: 14615490
Title: Intermedin is a calcitonin/calcitonin gene-related peptide family peptide acting through the calcitonin receptor-like receptor/receptor activity-modifying protein receptor complexes.
PubMed ID: 14706825
Title: Identification of novel adrenomedullin in mammals: a potent cardiovascular and renal regulator.
PubMed ID: 16359754
Title: Immunocytochemical localization of adrenomedullin 2/intermedin-like immunoreactivity in human hypothalamus, heart and kidney.
PubMed ID: 10591208
Title: The DNA sequence of human chromosome 22.